PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00033688001
Common NameGSBRNA2T00033688001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 342aa    MW: 38079 Da    PI: 5.8711
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00033688001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY356.74.2e-10912901286
              FLO_LFY   1 mdpeafsaslfkwd.praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddl 89 
                          mdpe f++ lf+w+ +ra++++pp  + +   ++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+
  GSBRNA2T00033688001   1 MDPEGFTSGLFRWNpTRAMVQQPPPPVPPP-PQQQPPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDM 89 
                          9*************4455555566555544.4556666777888888899**************************************** PP

              FLO_LFY  90 mkslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqe..ekeaagsggeglge 170
                          m+sls+ifr++llvGeryG+kaavraerrrl e  ee++++rr+ll      + +++aldalsqeglseepv++  +++aag++g+g g 
  GSBRNA2T00033688001  90 MNSLSHIFRWELLVGERYGVKAAVRAERRRLLEeeEEESSRRRHLLlsaagDSGTHHALDALSQEGLSEEPVHQleHTDAAGNNGGGGGY 179
                          ******************************976344556777887778844344556***************996333366677777667 PP

              FLO_LFY 171 aelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedge....erqrehPfivtepgevargkknGLDYLfdLy 256
                          +++ +a+       kk +  +++++k++ + + e+d+d +e +d+d+ ++g +g     erqrehPfivtepgevargkknGLDYLf+Ly
  GSBRNA2T00033688001 180 WDAGQAK------MKKPQ--QRRRKKQMVT-SVETDDDMNEGDDDDDGNGGGGGGvlgiERQREHPFIVTEPGEVARGKKNGLDYLFHLY 260
                          7665444......22222..2333333333.3344444444444444433333223555******************************* PP

              FLO_LFY 257 eqCrefLlqvqkiakerGekcPtkvtnqvf 286
                          eqCrefL+qvq+iak+rGekcPtkv  + f
  GSBRNA2T00033688001 261 EQCREFLIQVQTIAKDRGEKCPTKVSSKTF 290
                          *************************99988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.7E-1171290IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QQPPPPVPPP PQQQPPATPQ TAAFGMRLGG LEGLFGPYGV  60
RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYGVK AAVRAERRRL  120
LEEEEEESSR RRHLLLSAAG DSGTHHALDA LSQEGLSEEP VHQLEHTDAA GNNGGGGGYW  180
DAGQAKMKKP QQRRRKKQMV TSVETDDDMN EGDDDDDGNG GGGGGVLGIE RQREHPFIVT  240
EPGEVARGKK NGLDYLFHLY EQCREFLIQV QTIAKDRGEK CPTKVSSKTF TLLLFLEKYI  300
YVAQKKEKYI YILVLSEFMR YGRDTIAIII DSCFKVSLTS H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A5e-35227290164PROTEIN LEAFY
2vy2_A5e-35227290164PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189197PQQRRRKKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6159370.0HQ615937.1 Brassica rapa LEAFYa (LFYa) mRNA, complete cds.
GenBankKR1904350.0KR190435.1 Brassica rapa subsp. pekinensis leafy 1 (LFY1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675387.11e-148PREDICTED: protein LEAFY
RefseqXP_013727957.11e-148PREDICTED: protein LEAFY
SwissprotQ009581e-133LFY_ARATH; Protein LEAFY
TrEMBLA0A078JY280.0A0A078JY28_BRANA; BnaCnng78420D protein
STRINGBra029305.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-111floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]